PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000125457
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 374aa    MW: 39903 Da    PI: 8.1103
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000125457genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.3e-164693148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+e dell++++k+ G g+W+t ++  g+ R++k+c++rw +yl
    MDP0000125457 46 RGPWTPEXDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRWMNYL 93
                     89******************************99************97 PP

2Myb_DNA-binding40.37.1e-13107144948
                      HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      + l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000125457 107 ENLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 144
                      6899**********.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-213795IPR009057Homeodomain-like
PROSITE profilePS5129414.7694193IPR017930Myb domain
SuperFamilySSF466891.37E-2643140IPR009057Homeodomain-like
SMARTSM007179.8E-114595IPR001005SANT/Myb domain
PfamPF002491.2E-134693IPR001005SANT/Myb domain
CDDcd001672.14E-94893No hitNo description
PROSITE profilePS5129422.18494148IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2296149IPR009057Homeodomain-like
SMARTSM007173.8E-1098146IPR001005SANT/Myb domain
PfamPF002491.6E-11107144IPR001005SANT/Myb domain
CDDcd001677.81E-10107144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MRNPSSSSKA TAAASATMTT ASPSSSKAGI AGGSKTPCCV KVGLKRGPWT PEXDELLANY  60
IKKEGEGRWR TLPKQAGLLR CGKSCRLRWM NYLRPSVKRG QIAPDKENLI LRLHRLLGNR  120
WSLIAGRIPG RTDNEIKNYW NTHLSKKLIS QGIDPRTHKP LNPDHHSAAA DADVGNTNKS  180
AAAAASSKAN NRFSNPNPSP PPSDRLVHQG ADPSINGNDG NIAIDDHDLG TIVHSCANMT  240
TSINNPDASS SAAAMGTLSL RTNNNSHAGV LLGGGGNEED EDINCCADDV FSSFLNSLIN  300
EDPFSVQHQL QQQVLHNGNV STHAAGAGSD HVPLISMTSA STMAPSTFGW DSAVLMSSAF  360
NQNDHQRVTD QTEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25441485108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158060.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201110.0KJ020111.1 Malus hybrid cultivar MYB12b protein (MYB12b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344668.10.0PREDICTED: transcription repressor MYB5-like
TrEMBLX2EZI40.0X2EZI4_9R
STRINGVIT_06s0004g00570.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.18e-78myb domain protein 5